PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615724.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 307aa    MW: 34432.1 Da    PI: 6.3959
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615724.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1061.9e-33171228259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCts++C+vkk+vers edp+vv++tYeg+Hnh+
  XP_009615724.1 171 EDGYRWRKYGQKAVKNSPFPRSYYRCTSQKCSVKKRVERSYEDPSVVITTYEGQHNHH 228
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.7E-35155230IPR003657WRKY domain
SuperFamilySSF1182902.48E-29162230IPR003657WRKY domain
PROSITE profilePS5081131.984165230IPR003657WRKY domain
SMARTSM007744.6E-39170229IPR003657WRKY domain
PfamPF031061.2E-26171228IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSDNNPFYHD YMGTGGVNNA FPNFFGDQNP SIYDQIPTNT QTLHQDFDPS SYMSTLTECL  60
HGSMDYNSLS NVLGMSCSSS EVVCPPSDQE SSRKNSAEIP LTPNSLVSSS SSEAGGEEDS  120
SKSKKDLQAN DQCEDGDDKS KKVSKVKKKG EKKQKEPRFA FMTKSEIDNL EDGYRWRKYG  180
QKAVKNSPFP RSYYRCTSQK CSVKKRVERS YEDPSVVITT YEGQHNHHCP ATLRGNAAAA  240
MLSPSFLSSS QLIPQDVLFA QMLTNPTNQN QLPINYSVYN YQQQPQLTPE YGLFQDMVAS  300
LIHKREP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-29160231778Probable WRKY transcription factor 4
2lex_A6e-29160231778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615724.10.0PREDICTED: probable WRKY transcription factor 71
RefseqXP_016468091.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM1BGK71e-118M1BGK7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000447211e-117(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-51WRKY DNA-binding protein 71